PDB entry 3gxn

View 3gxn on RCSB PDB site
Description: Crystal structure of apo alpha-galactosidase A at pH 4.5
Class: Hydrolase
Keywords: hydrolase, Disease mutation, Disulfide bond, Glycoprotein, Glycosidase, Lysosome, RNA editing
Deposited on 2009-04-02, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.239
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gxna1, d3gxna2
  • Chain 'B':
    Compound: Alpha-galactosidase A
    Species: Homo sapiens [TaxId:9606]
    Gene: GLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gxnb1, d3gxnb2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gxnA (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gxnA (A:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gxnB (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentmqmslkdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gxnB (B:)
    ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
    ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
    ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
    qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
    nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdplgkqgyql
    rqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacfitqllpvk
    rklgfyewtsrlrshinptgtvllqlentm