PDB entry 3gx8

View 3gx8 on RCSB PDB site
Description: Structural and biochemical characterization of yeast monothiol glutaredoxin Grx5
Deposited on 2009-04-01, released 2010-04-14
The last revision was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.176
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monothiol glutaredoxin-5, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GRX5
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3gx8A (A:)
lsteirkaiedaiesapvvlfmkgtpefpkcgfsratigllgnqgvdpakfaaynvledp
elregikefsewptipqlyvnkefiggcdvitsmarsgeladlleeaqalvpeeeeetkd
r

    Sequence, based on observed residues (ATOM records):
    >3gx8A (A:)
steirkaiedaiesapvvlfmkgtpefpkcgfsratigllgnqgvdpakfaaynvledpe
lregikefsewptipqlyvnkefiggcdvitsmarsgeladlleeaqalvp