PDB entry 3gwo

View 3gwo on RCSB PDB site
Description: Structure of the C-terminal Domain of a Putative HIV-1 gp41 Fusion Intermediate
Deposited on 2009-04-01, released 2009-12-15
The last revision was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.233
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
  • Heterogens: JEF, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3gwoA (A:)
ewdreinnytslihslieesqnqqekneqelleldkwaslwnwfnitnwlwyik

    Sequence, based on observed residues (ATOM records):
    >3gwoA (A:)
wdreinnytslihslieesqnqqekneqelleldkwaslwnwfnitnwlwyik

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3gwoB (B:)
ewdreinnytslihslieesqnqqekneqelleldkwaslwnwfnitnwlwyik

    Sequence, based on observed residues (ATOM records):
    >3gwoB (B:)
lihslieesqnqqekneqelleldkwaslwnwfnitnwlwy