PDB entry 3gwm

View 3gwm on RCSB PDB site
Description: Crystal structure of the holo-[Acyl-Carrier-Protein] Synthase (ACPS) from Mycobacterium smegmatis
Class: transferase
Keywords: Homo-trimer, 9-stand pseudo beta barrel protein, Cytoplasm, Fatty acid biosynthesis, Lipid synthesis, Magnesium, Metal-binding, Transferase
Deposited on 2009-04-01, released 2010-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gwma_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gwmA (A:)
    aivgvgidlvsipdfaeqvdrpgtvfaetftpgerrdaadksssaarhlaarwaakeavi
    kawsssrfskrpalpegihrdievvtdmwgrpkvrlsgeiakhledvtihvslthedqta
    aavaiieep