PDB entry 3gwl

View 3gwl on RCSB PDB site
Description: Crystal structure of ASFV pB119L, a viral sulfhydryl oxidase
Class: oxidoreductase
Keywords: HOMODIMER, FIVE-HELIX BUNDLE, Disulfide bond, FAD, Flavoprotein, Late protein, Oxidoreductase, Virulence
Deposited on 2009-04-01, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FAD-linked sulfhydryl oxidase
    Species: African swine fever virus BA71V [TaxId:10498]
    Gene: 9GL, B119L, Ba71V-073
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q65163 (3-105)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3gwla1, d3gwla2
  • Chain 'B':
    Compound: FAD-linked sulfhydryl oxidase
    Species: African swine fever virus BA71V [TaxId:10498]
    Gene: 9GL, B119L, Ba71V-073
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q65163 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3gwlb1, d3gwlb2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gwlA (A:)
    gshmlhwgpkywrslhlyaiffsdapswkekyeaiqwilnfieslpctrcqhhafsyltk
    npltlnnsedfqywtfafhnnvnnrlnkkiiswseykniyeqsilk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gwlB (B:)
    gshmlhwgpkywrslhlyaiffsdapswkekyeaiqwilnfieslpctrcqhhafsyltk
    npltlnnsedfqywtfafhnnvnnrlnkkiiswseykniyeqsilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gwlB (B:)
    hmlhwgpkywrslhlyaiffsdapswkekyeaiqwilnfieslpctrcqhhafsyltknp
    ltlnnsedfqywtfafhnnvnnrlnkkiiswseykniyeqsi