PDB entry 3gwg

View 3gwg on RCSB PDB site
Description: Crystal structure of CheY of Helicobacter pylori
Class: signaling protein
Keywords: Chemotaxis, sulfate-bound CheY, Cytoplasm, Flagellar rotation, Magnesium, Metal-binding, Phosphoprotein, Two-component regulatory system, SIGNALING PROTEIN
Deposited on 2009-04-01, released 2010-03-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.149
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY homolog
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: CheY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3gwga_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3gwgA (A:)
gplgsmkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitdwn
mpemngldlvkkvrsdsrfkeipiimitteggkaevitalkagvnnyivkpftpqvlkek
levvlgtnd

    Sequence, based on observed residues (ATOM records): (download) 
    >3gwgA (A:)
mkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitdwnmpemn
gldlvkkvrsdsrfkeipiimitteggkaevitalkagvnnyivkpftpqvlkeklevvl
gtn