PDB entry 3gwa

View 3gwa on RCSB PDB site
Description: 1.6 Angstrom crystal structure of 3-oxoacyl-(acyl-carrier-protein) synthase III
Class: transferase
Keywords: structural genomics, acyl carrier protein, synthetase, Transferase, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-03-31, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.193
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-(Acyl-carrier-protein) synthase III
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: fabH, BURPS1710b_0096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gwaa1, d3gwaa2
  • Chain 'B':
    Compound: 3-oxoacyl-(Acyl-carrier-protein) synthase III
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: fabH, BURPS1710b_0096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gwab1, d3gwab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gwaA (A:)
    mahhhhhhmgtleaqtqgpgsmtpaahppraaiadiaghlpeqvltndvlaqlypdwpae
    kilaktgirerriaapretaadlayeaarklfaqgavgadqvdfvilctqapdyvlptsa
    cmlqhrlgipthagaldvnlgcsgyvyglslakglvetgaarcvllltadtyskylhpld
    ksvrtlfgdgasataviaehgelerigpfvfgtdgrgapnlivkaglfrepksadsareh
    edasgnvrtdehlymngaevmafslaevpraadrllalageprenidcfvlhqanrfmld
    alrkkmkipehkfpvlmehcgntvsstlplaletmrangtlargmrlmllgfgvgyswag
    clvnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gwaA (A:)
    praaiadiaghlpeqvltndvlaqlypdwpaekilaktgirerriaapretaadlayeaa
    rklfaqgavgadqvdfvilctqapdyvlptsacmlqhrlgipthagaldvnlgcsgyvyg
    lslakglvetgaarcvllltadtyskylhpldksvrtlfgdgasataviaehgelerigp
    fvfgtdgrgapnlivkaglfrepksadsarehedasgnvrtdehlymngaevmafslaev
    praadrllalageprenidcfvlhqanrfmldalrkkmkipehkfpvlmehcgntvsstl
    plaletmrangtlargmrlmllgfgvgyswagclvnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gwaB (B:)
    mahhhhhhmgtleaqtqgpgsmtpaahppraaiadiaghlpeqvltndvlaqlypdwpae
    kilaktgirerriaapretaadlayeaarklfaqgavgadqvdfvilctqapdyvlptsa
    cmlqhrlgipthagaldvnlgcsgyvyglslakglvetgaarcvllltadtyskylhpld
    ksvrtlfgdgasataviaehgelerigpfvfgtdgrgapnlivkaglfrepksadsareh
    edasgnvrtdehlymngaevmafslaevpraadrllalageprenidcfvlhqanrfmld
    alrkkmkipehkfpvlmehcgntvsstlplaletmrangtlargmrlmllgfgvgyswag
    clvnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gwaB (B:)
    praaiadiaghlpeqvltndvlaqlypdwpaekilaktgirerriaapretaadlayeaa
    rklfaqgavgadqvdfvilctqapdyvlptsacmlqhrlgipthagaldvnlgcsgyvyg
    lslakglvetgaarcvllltadtyskylhpldksvrtlfgdgasataviaehgelerigp
    fvfgtdgrgapnlivkaglfrepksadsarehedasgnvrtdehlymngaevmafslaev
    praadrllalageprenidcfvlhqanrfmldalrkkmkipehkfpvlmehcgntvsstl
    plaletmrangtlargmrlmllgfgvgyswagclvnf