PDB entry 3gw2

View 3gw2 on RCSB PDB site
Description: Crystal structure of possible transcriptional regulatory protein (fragment 1-100) from Mycobacterium bovis. Northeast Structural Genomics Consortium Target MbR242E.
Class: transcription regulator
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, MbR242E, Q7U294, Northeast Structural Genomics Consortium, NESG, DNA-binding, Transcription, Transcription regulation, Transferase, TRANSCRIPTION REGULATOR
Deposited on 2009-03-31, released 2009-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Possible transcriptional regulatory arsR-family protein
  Species: Mycobacterium bovis [TaxId:233413]
  Gene: Mb0332
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7U294
  Domains in SCOPe 2.08: d3gw2a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3gw2A (A:)
  magqsdrkaalldqvarvgkalangrrlqildllaqgeraveaiatatgmnlttasanlq
  alksgglvearregtrqyyriagedvarlfalvqvvadehlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3gw2A (A:)
  rkaalldqvarvgkalangrrlqildllaqgeraveaiatatgmnlttasanlqalksgg
  lvearregtrqyyriagedvarlfalvqvvade