PDB entry 3gw1

View 3gw1 on RCSB PDB site
Description: The structure of the Caulobacter crescentus CLPs protease adaptor protein in complex with FGG tripeptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, PEPTIDE BINDING PROTEIN
Deposited on 2009-03-31, released 2009-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gw1a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gw1b_
  • Chain 'C':
    Compound: FGG peptide
  • Chain 'D':
    Compound: FGG peptide
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3gw1A (A:)
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3gw1A (A:)
pslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetk
vaqvidsarrhqhplqctmekd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3gw1B (B:)
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3gw1B (B:)
pslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetk
vaqvidsarrhqhplqctmekd

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.