PDB entry 3gvu

View 3gvu on RCSB PDB site
Description: The crystal structure of human ABL2 in complex with GLEEVEC
Class: transferase
Keywords: Tyrosine kinase, ABL, Abelson murine leukemia viral oncogene, ATP-binding, Cell adhesion, Cytoskeleton, Kinase, Lipoprotein, Magnesium, Manganese, Metal-binding, Myristate, Nucleotide-binding, Phosphoprotein, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2009-03-31, released 2009-04-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42684 (24-291)
      • expression tag (14-23)
    Domains in SCOPe 2.04: d3gvua_
  • Heterogens: STI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gvuA (A:)
    mghhhhhhssgvdlgtenlyfqsmdkwemertditmkhklgggqygevyvgvwkkysltv
    avktlkedtmeveeflkeaavmkeikhpnlvqllgvctleppfyivteympygnlldylr
    ecnreevtavvllymatqissameylekknfihrdlaarnclvgenhvvkvadfglsrlm
    tgdtytahagakfpikwtapeslayntfsiksdvwafgvllweiatygmspypgidlsqv
    ydllekgyrmeqpegcppkvyelmracwkwspadrpsfaethqafetmfhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gvuA (A:)
    gtenlyfqsmdkwemertditmkhklgggqygevyvgvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctleppfyivteympygnlldylrecnreevtavvlly
    matqissameylekknfihrdlaarnclvgenhvvkvadfglsrgdtytakfpikwtape
    slayntfsiksdvwafgvllweiatygmspypgidlsqvydllekgyrmeqpegcppkvy
    elmracwkwspadrpsfaethqafetmfhds