PDB entry 3gvh

View 3gvh on RCSB PDB site
Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis
Class: oxidoreductase
Keywords: LACTATE/MALATE DEHYDROGENASE, BRUCELLA MELITENSIS, NAD, Oxidoreductase, Tricarboxylic acid cycle, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-03-31, released 2009-04-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvha1, d3gvha2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvhb1, d3gvhb2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvhc1, d3gvhc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvhd1, d3gvhd2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gvhA (A:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gvhA (A:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafvicitn
    pldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmv
    plarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiq
    maesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdks
    vasvaglceacigiapsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gvhB (B:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gvhB (B:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvpsrddllginlkvmeqvgagikkyapeafvicitnpldam
    vwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmvplary
    stvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesy
    lkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdksvasva
    glceacigiapsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gvhC (C:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gvhC (C:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvpsrddllginlkvmeqvgagikkyapeafvicitnpldam
    vwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmvplary
    stvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesy
    lkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdksvasva
    glceacigiapsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gvhD (D:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gvhD (D:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvpsrddllginlkvmeqvgagikkyapeafvicitnpldam
    vwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmvplary
    stvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesy
    lkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdksvasva
    glceacigiapsl