PDB entry 3gv6

View 3gv6 on RCSB PDB site
Description: Crystal Structure of human chromobox homolog 6 (CBX6) with H3K9 peptide
Class: Transcription/DNA binding protein
Keywords: chromobox homolog,CBX6,H3K9 peptide,SGC, Chromatin regulator, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation, Chromosomal protein, DNA-binding, Nucleosome core, Transcription-DNA binding protein COMPLEX, Structural Genomics, Structural Genomics Consortium
Deposited on 2009-03-30, released 2009-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.214
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gv6a_
  • Chain 'B':
    Compound: Histone H3K9me3 peptide
    Species: Xenopus laevis, synthetic [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gv6A (A:)
    ervfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeqkerere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gv6A (A:)
    ervfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeqkere
    

  • Chain 'B':
    No sequence available.