PDB entry 3gv4

View 3gv4 on RCSB PDB site
Description: crystal structure of human hdac6 zinc finger domain and ubiquitin c- terminal peptide rlrgg
Deposited on 2009-03-30, released 2009-04-28
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: HDAC6, KIAA0901, JM21
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: ubiquitin C-terminal peptide RLRGG
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3GV4 (Start-4)
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3gv4A (A:)
plpwcphlvavcpipaagldvtqpcgdcgtiqenwvclscyqvycgryinghmlqhhgns
ghplvlsyidlsawcyycqayvhhqalldvkniahqnkfgedmphph

    Sequence, based on observed residues (ATOM records):
    >3gv4A (A:)
plpwcphlvavcpipaagldvtqpcgdcgtiqenwvclscyqvycgryinghmlqhhgns
ghplvlsyidlsawcyycqayvhhqalldvkniahqnkf

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3gv4H (H:)
rlrgg

    Sequence, based on observed residues (ATOM records):
    >3gv4H (H:)
lrgg