PDB entry 3gub

View 3gub on RCSB PDB site
Description: Crystal structure of DAPKL93G complexed with N6-(2-Phenylethyl)adenosine
Class: Transferase
Keywords: gatekeeper mutant, kinase-ADP complex, Alternative splicing, ANK repeat, Apoptosis, ATP-binding, Calmodulin-binding, Cytoplasm, Kinase, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2009-03-29, released 2010-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.197
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK, DAPK1, death-associated protein kinase 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53355
      • engineered (92)
      • expression tag (291-292)
    Domains in SCOPe 2.06: d3guba1, d3guba2
  • Heterogens: GUB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gubA (A:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdviligelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gubA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdviligelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikpqf