PDB entry 3gt8

View 3gt8 on RCSB PDB site
Description: Crystal structure of the inactive EGFR kinase domain in complex with AMP-PNP
Class: transferase
Keywords: inactive kinase, dimer, Alternative splicing, Anti-oncogene, ATP-binding, Cell cycle, Cell membrane, Disease mutation, Disulfide bond, Glycoprotein, Isopeptide bond, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase, Ubl conjugation
Deposited on 2009-03-27, released 2009-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered (255)
    Domains in SCOPe 2.07: d3gt8a_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered (255)
    Domains in SCOPe 2.07: d3gt8b_
  • Chain 'C':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered (255)
    Domains in SCOPe 2.07: d3gt8c_
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered (255)
    Domains in SCOPe 2.07: d3gt8d_
  • Chain 'X':
    Compound: Unknown peptide
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gt8A (A:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gt8A (A:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
    ldeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglaklpikwmalesilhriythq
    sdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwmid
    adsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gt8B (B:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gt8B (B:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
    deayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglaklpikwmalesilhriythqs
    dvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwmida
    dsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gt8C (C:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gt8C (C:)
    pnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkanke
    ildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwc
    vqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriy
    thqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcw
    midadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gt8D (D:)
    gamgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gt8D (D:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
    deayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglaklpikwmalesilhriythqs
    dvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimrkcwmida
    dsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddv
    

  • Chain 'X':
    No sequence available.