PDB entry 3gt3

View 3gt3 on RCSB PDB site
Description: Structure of proteinase K with the mad triangle B3C
Class: hydrolase
Keywords: PHASING TOOL, 5-AMINO-2, 4, 6-TRIIODOISOPHTHALIC ACID, I3C, MAGIC TRIANGLE, 6-TRIBROMOISOPHTHALIC ACID, B3C, MAD TRIANGLE, Disulfide bond, Hydrolase, Metal-binding, Protease, Serine protease, Zymogen
Deposited on 2009-03-27, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Engyodontium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06873 (0-278)
      • conflict (206)
    Domains in SCOPe 2.07: d3gt3a_
  • Heterogens: BRV, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gt3A (A:)
    aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
    yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
    rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
    gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
    gkttaasacryiadtankgdlsnipfgtvnllaynnyqa