PDB entry 3gsp

View 3gsp on RCSB PDB site
Description: ribonuclease t1 complexed with 2',3'-cgps + 3'-gmp, 4 days
Deposited on 1997-12-02, released 1998-08-12
The last revision prior to the SCOP 1.59 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d3gsp__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gsp_ (-)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect