PDB entry 3gsd

View 3gsd on RCSB PDB site
Description: 2.05 Angstrom structure of a divalent-cation tolerance protein (CutA) from Yersinia pestis
Class: metal binding protein
Keywords: CutA, idp00456, divalent-cation tolerance protein, Metal-binding, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, METAL BINDING PROTEIN
Deposited on 2009-03-26, released 2009-04-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.159
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsda_
  • Chain 'B':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdb_
  • Chain 'C':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdc_
  • Chain 'D':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdd_
  • Chain 'E':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsde_
  • Chain 'F':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdf_
  • Chain 'G':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdg_
  • Chain 'H':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdh_
  • Chain 'I':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdi_
  • Chain 'J':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdj_
  • Chain 'K':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdk_
  • Chain 'L':
    Compound: Divalent-cation tolerance protein cutA
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: cutA, y0604, YPO0346, YP_0500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gsdl_
  • Heterogens: NA, PEG, EPE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gsdA (A:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdA (A:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gsdB (B:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdB (B:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gsdC (C:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdC (C:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gsdD (D:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdD (D:)
    snaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfks
    ntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3gsdE (E:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdE (E:)
    snaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfks
    ntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3gsdF (F:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdF (F:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3gsdG (G:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdG (G:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3gsdH (H:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdH (H:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3gsdI (I:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdI (I:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3gsdJ (J:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdJ (J:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3gsdK (K:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdK (K:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3gsdL (L:)
    snamsdsdamtdpnavsysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatsly
    ywegkleqeyevqllfksntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnas
    ll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gsdL (L:)
    ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
    sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll