PDB entry 3grw

View 3grw on RCSB PDB site
Description: FGFR3 in complex with a Fab
Class: transferase/immune system
Keywords: FGFR3, Fab, protein-protein complex, receptor tyrosine kinase, ATP-binding, Immunoglobulin domain, Kinase, Membrane, Nucleotide-binding, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, TRANSFERASE-IMMUNE SYSTEM COMPLEX
Deposited on 2009-03-26, released 2009-05-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3grwa1, d3grwa2
  • Chain 'H':
    Compound: Fab heavy chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GRW (0-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GRW (0-213)
    Domains in SCOPe 2.04: d3grwl1, d3grwl2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3grwA (A:)
    adpdtgvdtgapywtrpermdkkllavpaantvrfrcpaagnptpsiswlkngrefrgeh
    riggiklrhqqwslvmesvvpsdrgnytcvvenkfgsirqtytldvlersphrpilqagl
    panqtavlgsdvefhckvysdaqphiqwlkhvevngskvgpdgtpyvtvlkswisesvea
    dvrlrlanvserdggeylcratnfigvaekafwlsvhgpraaeeelveadeagsvhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3grwA (A:)
    apywtrpermdkkllavpaantvrfrcpaagnptpsiswlkngrefrgehriggiklrhq
    qwslvmesvvpsdrgnytcvvenkfgsirqtytldvlersphrpilqaglpanqtavlgs
    dvefhckvysdaqphiqwlkhvevngskvgpdgtpyvtvlkswisesveadvrlrlanvs
    erdggeylcratnfigvaekafwlsv
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3grwL (L:)
    diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
    rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec