PDB entry 3grg

View 3grg on RCSB PDB site
Description: Crystal structure of the F87M/L110M mutant of human transthyretin at pH 7.5
Class: transport protein
Keywords: transthyretin, Amyloid, Amyloidosis, Disease mutation, Gamma-carboxyglutamic acid, Glycoprotein, Hormone, Neuropathy, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on 2009-03-25, released 2010-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (86)
      • engineered (109)
    Domains in SCOPe 2.07: d3grga_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (86)
      • engineered (109)
    Domains in SCOPe 2.07: d3grgb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (86)
      • engineered (109)
    Domains in SCOPe 2.07: d3grgc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered (86)
      • engineered (109)
    Domains in SCOPe 2.07: d3grgd_
  • Heterogens: ZN, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3grgA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3grgA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3grgB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3grgB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3grgC (C:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3grgC (C:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3grgD (D:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3grgD (D:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn