PDB entry 3gqu

View 3gqu on RCSB PDB site
Description: pyrococcus horikoshii nop5 rna binding domain
Deposited on 2009-03-24, released 2009-04-21
The last revision was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nop5p protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: NOP5P, PH0053
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3gquA (A:)
    grmriqeqsgardkmvigaggledyidkamddvapnlkalvgaklgarlislagglkela
    mlpsstiqvlgaekalfrhlrtgakppkhgviyqypainrspwwqrgkiaralagklaia
    arvdyfsgeyiaeelkkelearikeikekyprppkrrkeerkgrkpwke
    

    Sequence, based on observed residues (ATOM records):
    >3gquA (A:)
    ggledyidkamddvapnlkalvgaklgarlislagglkelamlpsstiqvlgahgviyqy
    painrspwwqrgkiaralagklaiaarvdyfsgeyiaeelkkelearikeikekypr