PDB entry 3gqt

View 3gqt on RCSB PDB site
Description: Crystal structure of glutaryl-CoA dehydrogenase from Burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methylamine
Class: oxidoreductase
Keywords: SSGCID, Seattle Structural Genomics Center for Infectious Disease, Glutaryl-CoA Dehydrogenase, BupsA.00027.a, Fragment Crystallography, Fragments of Life, Oxidoreductase
Deposited on 2009-03-24, released 2009-04-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gqta1, d3gqta2
  • Chain 'B':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gqtb1, d3gqtb2
  • Chain 'C':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gqtc1, d3gqtc2
  • Chain 'D':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gqtd1, d3gqtd2
  • Heterogens: UFO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gqtA (A:)
    gpgsmaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifr
    emgeigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgs
    daqkekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspia
    dvfvvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeeni
    lphvkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkl
    admqteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisd
    efgvarhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqtA (A:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfglteppgsmvtrarkvpggyslsgskmwitnspiadvfvvwaklded
    grdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpft
    clnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglq
    gvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvarhlvnle
    vvntyhdihalilgraqtgiqaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gqtB (B:)
    gpgsmaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifr
    emgeigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgs
    daqkekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspia
    dvfvvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeeni
    lphvkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkl
    admqteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisd
    efgvarhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqtB (B:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwaklddeirg
    filekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftclnsary
    giawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvlrlgr
    mkdegtaaveitsimkrnscgkaldiarlardmlgfgvarhlvnlevvntyegthdihal
    ilgraqtgiqaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gqtC (C:)
    gpgsmaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifr
    emgeigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgs
    daqkekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspia
    dvfvvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeeni
    lphvkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkl
    admqteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisd
    efgvarhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqtC (C:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
    kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkgl
    rgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqtei
    tlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlgefgvarhlvnlev
    vntyegthdihalilgraqtgiqaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gqtD (D:)
    gpgsmaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifr
    emgeigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgs
    daqkekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspia
    dvfvvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeeni
    lphvkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkl
    admqteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisd
    efgvarhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqtD (D:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwaklddeirg
    filekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftclnsary
    giawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvlrlgr
    mkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvarhlvnlevvntyeh
    dihalilgraqtgiqa