PDB entry 3gqr

View 3gqr on RCSB PDB site
Description: Crystal structure determination of cat (Felis silvestris catus) hemoglobin at 2.4 angstrom resolution
Class: Oxygen storage, Oxygen transport
Keywords: LOW OXYGEN AFFINITY, METHEMOGLOBIN, ORTHORHOMBIC, Heme, Iron, Oxygen transport, Transport, Polymorphism, Oxygen storage
Deposited on 2009-03-24, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Felis silvestris catus [TaxId:9685]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gqra_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-A/B
    Species: Felis silvestris catus [TaxId:9685]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gqrb_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha
    Species: Felis silvestris catus [TaxId:9685]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gqrc_
  • Chain 'D':
    Compound: Hemoglobin subunit beta-A/B
    Species: Felis silvestris catus [TaxId:9685]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gqrd_
  • Chain 'E':
    Compound: Hemoglobin subunit alpha
    Species: Felis silvestris catus [TaxId:9685]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gqre_
  • Chain 'F':
    Compound: Hemoglobin subunit beta-A/B
    Species: Felis silvestris catus [TaxId:9685]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gqrf_
  • Chain 'G':
    Compound: Hemoglobin subunit alpha
    Species: Felis silvestris catus [TaxId:9685]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gqrg_
  • Chain 'H':
    Compound: Hemoglobin subunit beta-A/B
    Species: Felis silvestris catus [TaxId:9685]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gqrh_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqrA (A:)
    vlsaadksnvkacwgkigshageygaealertfcsfpttktyfphfdlshgsaqvkahgq
    kvadaltqavahmddlptamsalsdlhayklrvdpvnfkflshcllvtlachhpaeftpa
    vhasldkffsavstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqrB (B:)
    fltaeekglvnglwgkvnvdevggealgrllvvypwtqrffesfgdlssadaimsnakvk
    ahgkkvlnsfsdglkniddlkgafaklselhcdklhvdpenfrllgnvlvcvlahhfghd
    fnpqvqaafqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqrC (C:)
    vlsaadksnvkacwgkigshageygaealertfcsfpttktyfphfdlshgsaqvkahgq
    kvadaltqavahmddlptamsalsdlhayklrvdpvnfkflshcllvtlachhpaeftpa
    vhasldkffsavstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqrD (D:)
    fltaeekglvnglwgkvnvdevggealgrllvvypwtqrffesfgdlssadaimsnakvk
    ahgkkvlnsfsdglkniddlkgafaklselhcdklhvdpenfrllgnvlvcvlahhfghd
    fnpqvqaafqkvvagvanalahkyh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqrE (E:)
    vlsaadksnvkacwgkigshageygaealertfcsfpttktyfphfdlshgsaqvkahgq
    kvadaltqavahmddlptamsalsdlhayklrvdpvnfkflshcllvtlachhpaeftpa
    vhasldkffsavstvltskyr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqrF (F:)
    fltaeekglvnglwgkvnvdevggealgrllvvypwtqrffesfgdlssadaimsnakvk
    ahgkkvlnsfsdglkniddlkgafaklselhcdklhvdpenfrllgnvlvcvlahhfghd
    fnpqvqaafqkvvagvanalahkyh
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqrG (G:)
    vlsaadksnvkacwgkigshageygaealertfcsfpttktyfphfdlshgsaqvkahgq
    kvadaltqavahmddlptamsalsdlhayklrvdpvnfkflshcllvtlachhpaeftpa
    vhasldkffsavstvltskyr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqrH (H:)
    fltaeekglvnglwgkvnvdevggealgrllvvypwtqrffesfgdlssadaimsnakvk
    ahgkkvlnsfsdglkniddlkgafaklselhcdklhvdpenfrllgnvlvcvlahhfghd
    fnpqvqaafqkvvagvanalahkyh