PDB entry 3gql

View 3gql on RCSB PDB site
Description: Crystal Structure of activated receptor tyrosine kinase in complex with substrates
Class: transferase/transferase inhibitor
Keywords: phosphorylated kinase, activation, ATP analog, ATP-binding, Craniosynostosis, Disease mutation, Disulfide bond, Dwarfism, Glycoprotein, Heparin-binding, Hypogonadotropic hypogonadism, Immunoglobulin domain, Kallmann syndrome, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR COMPLEX
Deposited on 2009-03-24, released 2009-08-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.252
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFBR, FGFR1, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-325)
      • engineered (39)
    Domains in SCOPe 2.04: d3gqla_
  • Chain 'B':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFBR, FGFR1, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered (39)
    Domains in SCOPe 2.04: d3gqlb_
  • Chain 'C':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFBR, FGFR1, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered (39)
    Domains in SCOPe 2.04: d3gqlc_
  • Heterogens: GQL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gqlA (A:)
    mghhhhhhmagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrv
    tkvavkmlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgn
    lreylqarrppgleycynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarn
    vlvtednvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgv
    llweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfk
    qlvedldrivaltsnqeyldlsmpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqlA (A:)
    yelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdate
    kdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeql
    sskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglarngrlpvkwm
    apealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctn
    elymmmrdcwhavpsqrptfkqlvedldrivaltsnqeyldlsmpld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gqlB (B:)
    mghhhhhhmagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrv
    tkvavkmlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgn
    lreylqarrppgleycynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarn
    vlvtednvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgv
    llweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfk
    qlvedldrivaltsnqeyldlsmpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqlB (B:)
    yelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdate
    kdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpppee
    qlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglarpvkwmap
    ealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnel
    ymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gqlC (C:)
    mghhhhhhmagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrv
    tkvavkmlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgn
    lreylqarrppgleycynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarn
    vlvtednvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgv
    llweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfk
    qlvedldrivaltsnqeyldlsmpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqlC (C:)
    yelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdate
    kdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeql
    sskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglarpvkwmapea
    lfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnelym
    mmrdcwhavpsqrptfkqlvedldrivaltsnqey