PDB entry 3gqi

View 3gqi on RCSB PDB site
Description: Crystal Structure of activated receptor tyrosine kinase in complex with substrates
Class: Transferase/Transferase inhibitor
Keywords: phosphorylated kinase, pY-recognition, tandem SH2 domains, ATP analog, ATP-binding, Craniosynostosis, Disease mutation, Disulfide bond, Dwarfism, Glycoprotein, Heparin-binding, Hypogonadotropic hypogonadism, Immunoglobulin domain, Kallmann syndrome, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, Hydrolase, Lipid degradation, SH2 domain, SH3 domain, Transducer, Transferase-Transferase Inhibitor COMPLEX
Deposited on 2009-03-24, released 2009-08-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.249
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFBR, FGFR1, FLG, FLT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered (39)
      • engineered (134-136)
    Domains in SCOPe 2.04: d3gqia_
  • Chain 'B':
    Compound: Phospholipase C-gamma-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PLCG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gqib1, d3gqib2
  • Heterogens: DVT, ACP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gqiA (A:)
    mghhhhhhmagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrv
    tkvavkmlksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgn
    lreylqarrppglefsfnpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarn
    vlvtednvmkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgv
    llweiftlggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfk
    qlvedldrivaltsnqeyldlsmpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqiA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppglef
    sfnpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
    lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
    vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
    qeyldls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqiB (B:)
    hssekwfhgklgagrdgrhiaerllteycietgapdgsflvresetfvgdytlsfwrngk
    vqhcrihsrqdagtpkffltdnlvfdslydlithyqqvplrcnefemrlsepvpqtnahe
    skewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrvqqegqtv
    mlgnsefdslvdlisyyekhplyrkmklrypineealekigtaepd