PDB entry 3gqb

View 3gqb on RCSB PDB site
Description: Crystal Structure of the A3B3 complex from V-ATPase
Class: hydrolase
Keywords: A3B3, V-ATPase, ATP synthesis, ATP-binding, Hydrogen ion transport, Hydrolase, Ion transport, Nucleotide-binding, Transport
Deposited on 2009-03-24, released 2009-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.251
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type ATP synthase alpha chain
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: atpA, TTHA1273
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56403 (0-577)
      • engineered (27)
      • engineered (234)
      • engineered (254)
      • engineered (506)
    Domains in SCOPe 2.06: d3gqba1, d3gqba2, d3gqba3, d3gqba4
  • Chain 'B':
    Compound: V-type ATP synthase beta chain
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: atpB, TTHA1272
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56404 (Start-463)
      • engineered (263)
    Domains in SCOPe 2.06: d3gqbb1, d3gqbb2, d3gqbb3
  • Chain 'C':
    Compound: V-type ATP synthase alpha chain
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: atpA, TTHA1273
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56403 (0-577)
      • engineered (27)
      • engineered (234)
      • engineered (254)
      • engineered (506)
    Domains in SCOPe 2.06: d3gqbc1, d3gqbc2, d3gqbc3, d3gqbc4
  • Chain 'D':
    Compound: V-type ATP synthase beta chain
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: atpB, TTHA1272
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56404 (Start-463)
      • engineered (263)
    Domains in SCOPe 2.06: d3gqbd1, d3gqbd2, d3gqbd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqbA (A:)
    miqgviqkiagpaviakgmlgarmydiskvgeeglvgeiirldgdtafvqvyedtsglkv
    gepvvstglplavelgpgmlngiydgiqrplerirektgiyitrgvvvhaldrekkwawt
    pmvkpgdevrggmvlgtvpefgfthkilvppdvrgrvkevkpageytveepvvvledgte
    lkmyhtwpvrrarpvqrkldpntpfltgmrildvlfpvamggtaaipgpfgsgksvtqqs
    lakwsnadvvvyvgsgergnemtdvlvefpeltdpktggplmhrtvliantsnmpvaare
    asiyvgvtiaeyfrdqgfsvalmadstsrwaealreissrleempaeegyppylaarlaa
    fyeragkvitlggeegavtivgavsppggdmsepvtqstlrivgafwrldaslafrrhfp
    ainwngsyslftsaldpwyrenvaedypelrdaisellqreaglqeivqlvgpdalqdae
    rlvievgriiredflqqnayhevdayssmkkaygimkmilafykeaeaaikrgvsideil
    qlpvlerigraryvseeefpayfeeamkeiqgafkala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gqbB (B:)
    mdllkkeytgityisgpllfvenakdlaygaivdikdgtgrvrggqvievseeyaviqvf
    eettgldlattsvslvedvarlgvskemlgrrfngigkpidglppitpekrlpitglpln
    pvarrkpeqfiqtgistidvmntlvrgqklpifsgsglpaneiaaqiarqatvrpdlsge
    gekeepfavvfaamgitqrelsyfiqefertgalsrsvlflnkaddptieriltprmalt
    vaeylafehdyhvlviltdmtnysealreigaareeipgrrgypgymytdlatiyeragv
    vegkkgsvtqipilsmpdddrthpipdltgyitegqiqlsrelhrkgiyppidplpslsr
    lmnngvgkgktredhkqvsdqlysayangvdirklvaiigedaltendrrylqfadafer
    ffinqgqqnrsieeslqiawallsmlpqgelkriskdhigkyyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqbB (B:)
    kkeytgityisgpllfvenakdlaygaivdikdgtgrvrggqvievseeyaviqvfeett
    gldlattsvslvedvarlgvskemlgrrfngigkpidglppitpekrlpitglplnpvar
    rkpeqfiqtgistidvmntlvrgqklpifsgsglpaneiaaqiarqatvrpdlsgegeke
    epfavvfaamgitqrelsyfiqefertgalsrsvlflnkaddptieriltprmaltvaey
    lafehdyhvlviltdmtnysealreigaareeipgrrgypgymytdlatiyeragvvegk
    kgsvtqipilsmpdddrthpipdltgyitegqiqlsrelhrkgiyppidplpslsrlmnn
    gvgkgktredhkqvsdqlysayangvdirklvaiigedaltendrrylqfadaferffin
    qgqqnrsieeslqiawallsmlpqgelkriskdhigkyyg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gqbC (C:)
    miqgviqkiagpaviakgmlgarmydiskvgeeglvgeiirldgdtafvqvyedtsglkv
    gepvvstglplavelgpgmlngiydgiqrplerirektgiyitrgvvvhaldrekkwawt
    pmvkpgdevrggmvlgtvpefgfthkilvppdvrgrvkevkpageytveepvvvledgte
    lkmyhtwpvrrarpvqrkldpntpfltgmrildvlfpvamggtaaipgpfgsgksvtqqs
    lakwsnadvvvyvgsgergnemtdvlvefpeltdpktggplmhrtvliantsnmpvaare
    asiyvgvtiaeyfrdqgfsvalmadstsrwaealreissrleempaeegyppylaarlaa
    fyeragkvitlggeegavtivgavsppggdmsepvtqstlrivgafwrldaslafrrhfp
    ainwngsyslftsaldpwyrenvaedypelrdaisellqreaglqeivqlvgpdalqdae
    rlvievgriiredflqqnayhevdayssmkkaygimkmilafykeaeaaikrgvsideil
    qlpvlerigraryvseeefpayfeeamkeiqgafkala
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gqbD (D:)
    mdllkkeytgityisgpllfvenakdlaygaivdikdgtgrvrggqvievseeyaviqvf
    eettgldlattsvslvedvarlgvskemlgrrfngigkpidglppitpekrlpitglpln
    pvarrkpeqfiqtgistidvmntlvrgqklpifsgsglpaneiaaqiarqatvrpdlsge
    gekeepfavvfaamgitqrelsyfiqefertgalsrsvlflnkaddptieriltprmalt
    vaeylafehdyhvlviltdmtnysealreigaareeipgrrgypgymytdlatiyeragv
    vegkkgsvtqipilsmpdddrthpipdltgyitegqiqlsrelhrkgiyppidplpslsr
    lmnngvgkgktredhkqvsdqlysayangvdirklvaiigedaltendrrylqfadafer
    ffinqgqqnrsieeslqiawallsmlpqgelkriskdhigkyyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gqbD (D:)
    kkeytgityisgpllfvenakdlaygaivdikdgtgrvrggqvievseeyaviqvfeett
    gldlattsvslvedvarlgvskemlgrrfngigkpidglppitpekrlpitglplnpvar
    rkpeqfiqtgistidvmntlvrgqklpifsgsglpaneiaaqiarqatvrpdlsgegeke
    epfavvfaamgitqrelsyfiqefertgalsrsvlflnkaddptieriltprmaltvaey
    lafehdyhvlviltdmtnysealreigaareeipgrrgypgymytdlatiyeragvvegk
    kgsvtqipilsmpdddrthpipdltgyitegqiqlsrelhrkgiyppidplpslsrlmnn
    gvgkgktredhkqvsdqlysayangvdirklvaiigedaltendrrylqfadaferffin
    qgqqnrsieeslqiawallsmlpqgelkriskdhigkyyg