PDB entry 3gq1

View 3gq1 on RCSB PDB site
Description: The structure of the caulobacter crescentus clpS protease adaptor protein in complex with a WLFVQRDSKE decapeptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, PEPTIDE BINDING PROTEIN
Deposited on 2009-03-23, released 2009-05-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.161
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3gq1a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3gq1b_
  • Chain 'C':
    Compound: WLFVQRDSKE peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3GQ1 (0-End)
  • Chain 'D':
    Compound: WLFVQRDSKE peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3GQ1 (0-End)
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gq1A (A:)
    tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
    etkvaqvidsarrhqhplqctmekd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gq1B (B:)
    tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
    etkvaqvidsarrhqhplqctmekd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.