PDB entry 3gq0

View 3gq0 on RCSB PDB site
Description: The structure of the Caulobacter crescentus clpS protease adaptor protein - apo structure with no peptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, PEPTIDE BINDING PROTEIN
Deposited on 2009-03-23, released 2009-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gq0a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gq0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3gq0A (A:)
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3gq0A (A:)
pslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetk
vaqvidsarrhqhplqctmekd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3gq0B (B:)
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3gq0B (B:)
qkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevae
tkvaqvidsarrhqhplqctmekd