PDB entry 3gpy

View 3gpy on RCSB PDB site
Description: sequence-matched mutm lesion recognition complex 3 (lrc3)
Deposited on 2009-03-23, released 2009-11-10
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA glycosylase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: mutM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84131 (0-272)
      • engineered mutation (164)
  • Chain 'B':
    Compound: DNA (5'-d(*ap*gp*gp*tp*ap*gp*ap*tp*cp*cp*gp*gp*ap*cp*gp*c)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: DNA (5'-d(*t*gp*cp*gp*tp*cp*cp*(8og)p*gp*ap*tp*cp*tp*ap*cp*c)-3')
    Species: synthetic, synthetic
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3gpyA (A:)
pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplaelgpeplspafspavlaeravktkrsvkallldctvvagfgniyvdesl
fragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhlyv
ygrqgnpckrcgtpiektvvagrgthycprcqr

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.