PDB entry 3gpp

View 3gpp on RCSB PDB site
Description: MutM encountering an intrahelical 8-oxoguanine (oxoG) lesion in EC3-T224P complex
Class: Lyase/DNA
Keywords: DNA glycosylase, DNA repair, damage search, base extrusion, disulfide crosslinking, DNA damage, DNA-binding, Glycosidase, Hydrolase, Lyase, Metal-binding, Multifunctional enzyme, Zinc-finger, Lyase-DNA COMPLEX
Deposited on 2009-03-23, released 2009-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA glycosylase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: mutM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84131 (0-272)
      • conflict (1)
      • engineered (164)
    Domains in SCOPe 2.08: d3gppa1, d3gppa2, d3gppa3
  • Chain 'B':
    Compound: DNA (5'-d(p*gp*gp*tp*ap*gp*ap*tp*cp*cp*gp*gp*ap*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(p*cp*gp*tp*cp*cp*(8og)p*gp*ap*tp*cp*tp*ap*c)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gppA (A:)
    pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
    lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
    keeadrrpplaelgpeplspafspavlaeravktkrsvkallldctvvagfgniyvdesl
    fragilpgrpaaslsskeierlheemvatigeavmkggstvrpyvntqgeagtfqhhlyv
    ygrqgnpckrcgtpiektvvagrgthycprcqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gppA (A:)
    pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
    lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
    keeadrrpplaelgpeplspafspavlaeravktkrsvkallldctvvagfgniyvdesl
    fragilpgrpaaslsskeierlheemvatigeavmlyvygrqgnpckrcgtpiektvvag
    rgthycprcqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.