PDB entry 3gpe

View 3gpe on RCSB PDB site
Description: Crystal Structure Analysis of PKC (alpha)-C2 domain complexed with Ca2+ and PtdIns(4,5)P2
Class: signaling protein
Keywords: CALCIUM/PHOSPHOLIPID BINDING DOMAIN, C2 domain, Phosphatidil serine, protein kinase, ATP-binding, Kinase, Metal-binding, Nucleotide-binding, Phorbol-ester binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Zinc-finger, SIGNALING PROTEIN
Deposited on 2009-03-23, released 2009-05-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.244
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C alpha type
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prkca, Pkca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3gpea_
  • Heterogens: CA, PO4, PT5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gpeA (A:)
    tekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkti
    rstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgwy
    kllnqeegeyynvpipe