PDB entry 3gpd

View 3gpd on RCSB PDB site
Description: twinning in crystals of human skeletal muscle d-glyceraldehyde-3-phosphate dehydrogenase
Class: oxidoreductase (nad(a)-aldehyde(d))
Keywords: oxidoreductase (nad(a)-aldehyde(d))
Deposited on 1983-06-20, released 1983-10-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.33
AEROSPACI score: -0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gpdg1, d3gpdg2
  • Chain 'R':
    Compound: d-glyceraldehyde-3-phosphate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gpdr1, d3gpdr2
  • Heterogens: SO4, NAD

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gpdG (G:)
    gkvkvgvdgfgrigrlvtraafnsgkvdivaindpfidlhymvymfqydsthgkfhgtvk
    aedgklvidgkaitifqerdpenikwgdagtayvvestgvfttmekagahlkggakrivi
    sapsadapmfvmgvnhfkyanslkiisnascttnclaplakvihdhfgiveglmttvhai
    tatqktvdspsgklwrggrgaaqnlipastgaakavgkvipeldgkltgmafrvptanvs
    vldltcrlekpakyddikkvvkeasegplkgilgytedevvsddfngsnhssifdagagi
    elndtfvklvswydnefgyservvdlmahmaske
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gpdR (R:)
    gkvkvgvdgfgrigrlvtraafnsgkvdivaindpfidlhymvymfqydsthgkfhgtvk
    aedgklvidgkaitifqerdpenikwgdagtayvvestgvfttmekagahlkggakrivi
    sapsadapmfvmgvnhfkyanslkiisnascttnclaplakvihdhfgiveglmttvhai
    tatqktvdspsgklwrggrgaaqnlipastgaakavgkvipeldgkltgmafrvptanvs
    vldltcrlekpakyddikkvvkeasegplkgilgytedevvsddfngsnhssifdagagi
    elndtfvklvswydnefgyservvdlmahmaske