PDB entry 3gpd

View 3gpd on RCSB PDB site
Description: twinning in crystals of human skeletal muscle d-glyceraldehyde-3- phosphate dehydrogenase
Deposited on 1983-06-20, released 1983-10-27
The last revision prior to the SCOP 1.55 freeze date was dated 1988-07-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.5 Å
R-factor: 0.33
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gpdG (G:)
    gkvkvgvdgfgrigrlvtraafnsgkvdivaindpfidlhymvymfqydsthgkfhgtvk
    aedgklvidgkaitifqerdpenikwgdagtayvvestgvfttmekagahlkggakrivi
    sapsadapmfvmgvnhfkyanslkiisnascttnclaplakvihdhfgiveglmttvhai
    tatqktvdspsgklwrggrgaaqnlipastgaakavgkvipeldgkltgmafrvptanvs
    vldltcrlekpakyddikkvvkeasegplkgilgytedevvsddfngsnhssifdagagi
    elndtfvklvswydnefgyservvdlmahmaske
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gpdR (R:)
    gkvkvgvdgfgrigrlvtraafnsgkvdivaindpfidlhymvymfqydsthgkfhgtvk
    aedgklvidgkaitifqerdpenikwgdagtayvvestgvfttmekagahlkggakrivi
    sapsadapmfvmgvnhfkyanslkiisnascttnclaplakvihdhfgiveglmttvhai
    tatqktvdspsgklwrggrgaaqnlipastgaakavgkvipeldgkltgmafrvptanvs
    vldltcrlekpakyddikkvvkeasegplkgilgytedevvsddfngsnhssifdagagi
    elndtfvklvswydnefgyservvdlmahmaske