PDB entry 3gpb

View 3gpb on RCSB PDB site
Description: comparison of the binding of glucose and glucose-1-phosphate derivatives to t-state glycogen phosphorylase b
Class: glycogen phosphorylase
Keywords: glycogen phosphorylase
Deposited on 1990-06-04, released 1992-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycogen phosphorylase b
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489 (Start-841)
      • conflict (379)
    Domains in SCOPe 2.07: d3gpba_
  • Heterogens: G1P, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gpbA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gpbA (A:)
    rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
    tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
    glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
    ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
    ndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiir
    rfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtv
    ktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrms
    lveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitpr
    rwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayl
    ereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggka
    apgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqista
    gteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaq
    eyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsa
    lyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdekip