PDB entry 3gp7

View 3gp7 on RCSB PDB site
Description: Staphylococcal Enterotoxin B mutant N23YK97SK98S
Class: toxin
Keywords: superantigen, enterotoxin, Disulfide bond, Secreted, Toxin
Deposited on 2009-03-23, released 2010-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01552
      • engineered (22)
      • engineered (96)
    Domains in SCOPe 2.07: d3gp7a1, d3gp7a2
  • Chain 'B':
    Compound: enterotoxin type b
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: entB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01552
      • engineered (22)
    Domains in SCOPe 2.07: d3gp7b1, d3gp7b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gp7A (A:)
    esqpdpkpdelhksskftglmeymkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfssstndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gp7A (A:)
    sqpdpkpdelhksskftglmeymkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfsskrktcmyggvtehngnqldkyrsi
    tvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfien
    ensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gp7B (B:)
    esqpdpkpdelhksskftglmeymkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfssstndinshqtdkrktcmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gp7B (B:)
    sqpdpkpdelhksskftglmeymkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyyyqcyfsrktcmyggvtehngnqldkyrsitv
    rvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfienen
    sfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk