PDB entry 3gp0

View 3gp0 on RCSB PDB site
Description: Crystal Structure of Human Mitogen Activated Protein Kinase 11 (p38 beta) in complex with Nilotinib
Class: Transferase/Transferase Inhibitor
Keywords: mitogen-activated protein kinase 11, P38B, P38BETA, PRKM11, SAPK2, SAPK2B, stress-activated protein kinase-2, structural genomics consortium, SGC, ATP-binding, Kinase, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Transferase-Transferase Inhibitor COMPLEX
Deposited on 2009-03-20, released 2009-04-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 11
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK11, PRKM11, SAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15759 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.05: d3gp0a_
  • Heterogens: NIL, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gp0A (A:)
    smragfyrqelnktvwevpqrlqglrpvgsgaygsvcsaydarlrqkvavkklsrpfqsl
    iharrtyrelrllkhlkhenviglldvftpatsiedfsevylvttlmgadlnnivkcqal
    sdehvqflvyqllrglkyihsagiihrdlkpsnvavnedcelrildfglarqadeemtgy
    vatrwyrapeimlnwmhynqtvdiwsvgcimaellqgkalfpgsdyidqlkrimevvgtp
    spevlakissehartyiqslppmpqkdlssifrganplaidllgrmlvldsdqrvsaaea
    lahayfsqyhdpedepeaepydesveakertleewkeltyqevlsfkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gp0A (A:)
    mragfyrqelnktvwevpqrlqglrpvgsvcsaydarlrqkvavkklsrpfqsliharrt
    yrelrllkhlkhenviglldvftpatsiedfsevylvttlmgadlnnivkcqalsdehvq
    flvyqllrglkyihsagiihrdlkpsnvavnedcelrildfgeemgyvatrwyrapeiml
    nwmhynqtvdiwsvgcimaellqgkalfpgsdyidqlkrimevvgtpspevlakisseha
    rtyiqslppmpqkdlssifrganplaidllgrmlvldsdqrvsaaealahayfsqyhdpe
    depeaepydesveakertleewkeltyqevlsf