PDB entry 3goq

View 3goq on RCSB PDB site
Description: Crystal structure of the Tyr13Met variant of Bacillus subtilis ferrochelatase
Class: lyase
Keywords: Cytoplasm, Heme biosynthesis, Iron, Lyase, Metal-binding, Porphyrin biosynthesis
Deposited on 2009-03-19, released 2010-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU10130, hemF, hemH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32396
      • engineered (12)
    Domains in SCOPe 2.07: d3goqa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3goqA (A:)
    msrkkmgllvmamgtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqit
    eqqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstf
    svqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamliv
    sahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltr
    dlfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidal
    atvvlkklgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3goqA (A:)
    rkkmgllvmamgtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteq
    qahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsv
    qsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsa
    hslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdl
    feqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalat
    vvlkklg