PDB entry 3gns

View 3gns on RCSB PDB site
Description: Crystal Structure of the Staphylococcus aureus Enoyl-Acyl Carrier Protein Reductase (FabI) in apo form (one molecule in AU)
Class: oxidoreductase
Keywords: Oxidoreductase, Rossmann fold, Enoyl reductase
Deposited on 2009-03-18, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.215
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Gene: FabI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GI75 (4-259)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d3gnsa1, d3gnsa2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gnsA (A:)
    laaamlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqln
    qpeahlyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfll
    aqdissysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylal
    dlgpdnirvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsd
    lssgvtgenihvdsgfhaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gnsA (A:)
    laaamlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqln
    qpeahlyqidvqsdeevingfeqigkdvgnidgvyhsiqdissysltivaheakklmpeg
    gsivattylynvmgvakasleanvkylaldlgpdnirvnaisagpirtlntilkeieera
    plkrnvdqvevgktaayllsdlssgvtgenihvdsgfhaik