PDB entry 3gnc

View 3gnc on RCSB PDB site
Description: Crystal structure of Glutaryl-COA dehydrogenase from Burkholderia Pseudomallei with fragment 6421
Class: oxidoreductase
Keywords: Oxidoreductase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-03-16, released 2009-07-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gnca1, d3gnca2
  • Chain 'B':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gncb1, d3gncb2
  • Chain 'C':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gncc1, d3gncc2
  • Chain 'D':
    Compound: Glutaryl-CoA dehydrogenase
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_3237
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gncd1, d3gncd2
  • Heterogens: SO4, QQQ, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gncA (A:)
    gpgsmaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifr
    emgeigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgs
    daqkekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspia
    dvfvvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeeni
    lphvkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkl
    admqteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisd
    efgvarhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gncA (A:)
    aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
    llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
    ylpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwakldedrd
    eirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftcln
    sarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvl
    rlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngdefgvarhlvnlevvnty
    egthdihalilgraqtgiqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gncB (B:)
    gpgsmaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifr
    emgeigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgs
    daqkekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspia
    dvfvvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeeni
    lphvkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkl
    admqteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisd
    efgvarhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gncB (B:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwakldedeir
    gfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftclnsar
    ygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvlrlg
    rmkdegtaaveitsimkrnscgkaldiarlardmlgfgvarhlvnlevvntyegthdiha
    lilgraqtgiqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gncC (C:)
    gpgsmaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifr
    emgeigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgs
    daqkekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspia
    dvfvvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeeni
    lphvkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkl
    admqteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisd
    efgvarhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gncC (C:)
    atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
    lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
    lpklatgewigcfgltepngsmvtrarkvpggyslsgskmwitnspiadvfvvwaklded
    grdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpft
    clnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglq
    gvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggndefgvarhlvnlevvn
    tyegthdihalilgraqtgiqaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gncD (D:)
    gpgsmaaatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifr
    emgeigllgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgs
    daqkekylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspia
    dvfvvwakldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeeni
    lphvkglrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkl
    admqteitlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisd
    efgvarhlvnlevvntyegthdihalilgraqtgiqaff
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gncD (D:)
    aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig
    llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek
    ylpklatgewigcfgltepsmvtrarkvpggyslsgskmwitnspiadvfvvwaklddei
    rgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkglrgpftclnsa
    rygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqteitlglqgvlrl
    grmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvarhlvnlevvnty
    egthdihalilgraqtgiqa