PDB entry 3gmy

View 3gmy on RCSB PDB site
Description: Crystal Structure of Beta-Lactamse Inhibitory Protein-Like Protein (BLP), Selenomethionine Derivative
Class: protein binding
Keywords: 2-layer alpha/beta sandwich, PROTEIN BINDING
Deposited on 2009-03-15, released 2009-03-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.203
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: blp
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: blp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gmya_
  • Chain 'B':
    Compound: blp
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: blp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3gmyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gmyA (A:)
    ytgftperynkiqfgmdrtlvwqlagadqscsdqveriicynnpdhygpqghfffnaadk
    lihkrqmelfpapkptmrlatynktqtgmteaqfwaavpsdtcsalaeqypnwpatngnl
    reyvcpskaerfapsayftftdgkltsrsqsqlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gmyB (B:)
    ytgftperynkiqfgmdrtlvwqlagadqscsdqveriicynnpdhygpqghfffnaadk
    lihkrqmelfpapkptmrlatynktqtgmteaqfwaavpsdtcsalaeqypnwpatngnl
    reyvcpskaerfapsayftftdgkltsrsqsqlp