PDB entry 3gmv

View 3gmv on RCSB PDB site
Description: Crystal Structure of Beta-Lactamse Inhibitory Protein-I (BLIP-I) in Apo Form
Class: protein binding
Keywords: 2-layer alpha/beta sandwich, PROTEIN BINDING
Deposited on 2009-03-15, released 2009-03-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Beta-lactamase inhibitory protein BLIP-I
  Species: Streptomyces exfoliatus [TaxId:1905]
  Gene: bliA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KJ90 (0-155)
  Domains in SCOPe 2.03: d3gmvx_
• Heterogens: TAM, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gmvX (X:)
  sgfsaekyeqiqfgmtfdevweigggeaacdtggvigdsilcftesgdyapyggfsftde
  gelwskrneylykaktpsvklshynrtalgmteaqlwaavpkdscvsqgesypnwpaktg
  feekyycaaatglfppsasfhltdgvltyryqrslt