PDB entry 3gm2

View 3gm2 on RCSB PDB site
Description: Crystal Structure of the Focal Adhesion Targeting (FAT) Domain of Pyk2
Class: transferase
Keywords: four-helix bundle, TRANSFERASE
Deposited on 2009-03-12, released 2009-05-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.261
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tyrosine kinase 2 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14289
      • engineered (42)
    Domains in SCOPe 2.02: d3gm2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gm2A (A:)
    gshmrlgaqsiqptanldrtddlvylnvmelvravlelknelaqlppegyvvvvknvglt
    lrkligsvddllpslpsssrteiegtqkllnkdlaelinkmrlaqqnavtslseeckrqm
    ltashtlavdaknlldavdqakvlanlahppae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gm2A (A:)
    rtddlvylnvmelvravlelknelaqlppegyvvvvknvgltlrkligsvddllpslpss
    srteiegtqkllnkdlaelinkmrlaqqnavtslseeckrqmltashtlavdaknlldav
    dqakvla