PDB entry 3gly

View 3gly on RCSB PDB site
Description: refined crystal structures of glucoamylase from aspergillus awamori var. x100
Class: hydrolase
Keywords: hydrolase
Deposited on 1994-06-03, released 1994-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucoamylase-471
    Species: Aspergillus awamori [TaxId:105351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22832 (0-469)
      • conflict (57)
      • conflict (59)
      • conflict (115)
    Domains in SCOPe 2.08: d3glya_
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3glyA (A:)
    atldswlsneatvartailnnigadgawvsgadsgivvaspstdnpdyfytwtrdsglvi
    ktlvdlfrngdtdllstiehyissqaiiqgvsnpsgdlssgglgepkfnvdetaytgswg
    rpqrdgpalratamigfgqwlldngytsaateivwplvrndlsyvaqywnqtgydlweev
    ngssfftiavqhralvegsafatavgsscswcdsqapqilcylqsfwtgsyilanfdssr
    sgkdtntllgsihtfdpeagcddstfqpcspralanhkevvdsfrsiytlndglsdseav
    avgrypedsyyngnpwflctlaaaeqlydalyqwdkqgsleitdvsldffkalysgaatg
    tyssssstyssivsavktfadgfvsivethaasngslseqfdksdgdelsardltwsyaa
    lltannrrnsvvppswgetsassvpgtcaatsasgtyssvtvtswpsiva