PDB entry 3glw
View 3glw on RCSB PDB site
Description: Quaternary Structure of Drosophila melanogaster IC/Tctex-1/LC8; Allosteric Interactions of Dynein Light Chains with Dynein Intermediate Chain
Class: contractile protein
Keywords: LC8, Tctex, Tctex-1, Intermediate Chain, IC, Dynein, Dynein Light Chain, Entropy, Allostery, Chelate Effect, Multivalent., Microtubule, Motor protein, CONTRACTILE PROTEIN
Deposited on
2009-03-12, released
2009-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.206
AEROSPACI score: 0.2
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Dynein light chain 1, cytoplasmic
Species: Drosophila melanogaster [TaxId:7227]
Gene: CTP, CDLC1, DDLC1, CG6998
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3glwa_ - Chain 'Z':
Compound: Dynein intermediate Chain
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3glwA (A:)
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg
Sequence, based on observed residues (ATOM records): (download)
>3glwA (A:)
rkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfg
syvthetrhfiyfylgqvaillfksg
- Chain 'Z':
No sequence available.