PDB entry 3glw

View 3glw on RCSB PDB site
Description: Quaternary Structure of Drosophila melanogaster IC/Tctex-1/LC8; Allosteric Interactions of Dynein Light Chains with Dynein Intermediate Chain
Class: contractile protein
Keywords: LC8, Tctex, Tctex-1, Intermediate Chain, IC, Dynein, Dynein Light Chain, Entropy, Allostery, Chelate Effect, Multivalent., Microtubule, Motor protein, CONTRACTILE PROTEIN
Deposited on 2009-03-12, released 2009-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.206
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, cytoplasmic
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CTP, CDLC1, DDLC1, CG6998
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3glwa_
  • Chain 'Z':
    Compound: Dynein intermediate Chain
    Database cross-references and differences (RAF-indexed):
    • PDB 3GLW
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3glwA (A:)
msdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgr
nfgsyvthetrhfiyfylgqvaillfksg

    Sequence, based on observed residues (ATOM records): (download) 
    >3glwA (A:)
rkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnfg
syvthetrhfiyfylgqvaillfksg

  • Chain 'Z':
    No sequence available.