PDB entry 3gls

View 3gls on RCSB PDB site
Description: Crystal Structure of Human SIRT3
Class: hydrolase
Keywords: NAD dependent deacetylase, sirtuin, apo structure, Hydrolase, Metal-binding, Mitochondrion, NAD, Polymorphism, Transit peptide, Zinc
Deposited on 2009-03-12, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.185
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase sirtuin-3, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT3, SIR2L3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3glsa_
  • Chain 'B':
    Compound: NAD-dependent deacetylase sirtuin-3, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT3, SIR2L3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3glsb_
  • Chain 'C':
    Compound: NAD-dependent deacetylase sirtuin-3, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT3, SIR2L3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3glsc_
  • Chain 'D':
    Compound: NAD-dependent deacetylase sirtuin-3, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT3, SIR2L3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3glsd_
  • Chain 'E':
    Compound: NAD-dependent deacetylase sirtuin-3, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT3, SIR2L3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3glse_
  • Chain 'F':
    Compound: NAD-dependent deacetylase sirtuin-3, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT3, SIR2L3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3glsf_
  • Heterogens: ZN, PGE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3glsA (A:)
    snasdkgklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlp
    ypeaifelpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidgle
    rvsgipasklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivff
    geplpqrfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawh
    prsrdvaqlgdvvhgveslvellgwteemrdlvqretgkldgpdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glsA (A:)
    klslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaife
    lpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgipa
    sklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpqr
    fllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdva
    qlgdvvhgveslvellgwteemrdlvqretgkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3glsB (B:)
    snasdkgklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlp
    ypeaifelpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidgle
    rvsgipasklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivff
    geplpqrfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawh
    prsrdvaqlgdvvhgveslvellgwteemrdlvqretgkldgpdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glsB (B:)
    lslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaifel
    pfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgipas
    klveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpqrf
    llhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdvaq
    lgdvvhgveslvellgwteemrdlvqretgkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3glsC (C:)
    snasdkgklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlp
    ypeaifelpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidgle
    rvsgipasklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivff
    geplpqrfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawh
    prsrdvaqlgdvvhgveslvellgwteemrdlvqretgkldgpdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glsC (C:)
    klslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaife
    lpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgipa
    sklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpqr
    fllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdva
    qlgdvvhgveslvellgwteemrdlvqretgkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3glsD (D:)
    snasdkgklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlp
    ypeaifelpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidgle
    rvsgipasklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivff
    geplpqrfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawh
    prsrdvaqlgdvvhgveslvellgwteemrdlvqretgkldgpdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glsD (D:)
    gklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaif
    elpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgip
    asklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpq
    rfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdv
    aqlgdvvhgveslvellgwteemrdlvqretgkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3glsE (E:)
    snasdkgklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlp
    ypeaifelpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidgle
    rvsgipasklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivff
    geplpqrfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawh
    prsrdvaqlgdvvhgveslvellgwteemrdlvqretgkldgpdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glsE (E:)
    gklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaif
    elpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgip
    asklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpq
    rfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdv
    aqlgdvvhgveslvellgwteemrdlvqretgkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3glsF (F:)
    snasdkgklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlp
    ypeaifelpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidgle
    rvsgipasklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivff
    geplpqrfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawh
    prsrdvaqlgdvvhgveslvellgwteemrdlvqretgkldgpdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glsF (F:)
    lslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaifel
    pfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgipas
    klveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpqrf
    llhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdvaq
    lgdvvhgveslvellgwteemrdlvqretgkl