PDB entry 3gln

View 3gln on RCSB PDB site
Description: Carbonmonoxy Ngb under Xenon pressure
Class: oxygen storage/transport protein
Keywords: neuroglobin, hemeprotein, xenon binding, cavities, OXYGEN STORAGE/TRANSPORT PROTEIN COMPLEX, Heme, Iron, Metal-binding, Oxygen transport, Transport
Deposited on 2009-03-12, released 2009-09-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97
      • engineered (57)
      • engineered (122)
    Domains in SCOPe 2.04: d3glna_
  • Heterogens: SO4, XE, CMO, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3glnA (A:)
    gshmerpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedsls
    spefldhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllyml
    ekslgpdftpatrtawsrlygavvqamsrgwdge
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glnA (A:)
    rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
    dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
    pdftpatrtawsrlygavvqamsrgw