PDB entry 3glm

View 3glm on RCSB PDB site
Description: Glutaconyl-coA decarboxylase A subunit from Clostridium symbiosum co-crystallized with crotonyl-coA
Class: lyase
Keywords: glutaconyl-CoA decarboxylase, sodium ion transport, biotin, glutamate fermentation, LYASE
Deposited on 2009-03-12, released 2009-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaconyl-CoA decarboxylase subunit A
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: GCDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3glma1, d3glma2
  • Chain 'B':
    Compound: Glutaconyl-CoA decarboxylase subunit A
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: GCDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3glmb1, d3glmb2
  • Chain 'C':
    Compound: Glutaconyl-CoA decarboxylase subunit A
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: GCDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3glmc1, d3glmc2
  • Chain 'D':
    Compound: Glutaconyl-CoA decarboxylase subunit A
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: GCDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3glmd1, d3glmd2
  • Heterogens: CL, COO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3glmA (A:)
    mnmysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnerg
    qlsamqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmag
    awvpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnq
    lgipvivgiygtnpagggyhsisptiliahqdanmavggagilsgmnpkgyiddeaaeqi
    iaaqiensklkvpapgsvpihydetgffrevyqndlgvidgikkyisylpaynleffrvd
    tpkapqlpaedlysiipmnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngl
    lvgvianvqgllmnypeykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgi
    dvgdeaekaellglgqsliysiensklpsleitirkasaaahyvlggpqgnntnvfsigt
    gaceyyvmpgetaanamysrklvkakkagedlqpiigkmndmiqmytdksrpkyctekgm
    vdeivdmtevrpyiqafteaayqnpqsicpmhqmltprstrefetfgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glmA (A:)
    mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql
    samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw
    vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg
    ipvivgiygtnpagggyhsisptiliahqdanmavggagaeqiiaaqiensklkvpapgs
    vpihydetgffrevyqndlgvidgikkyisylpaynleffrvdtpkapqlpaedlysiip
    mnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngllvgvianvqgllmnype
    ykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgidvgdeaekaellglgqs
    liysiensklpsleitirkasaaahyvlggpqgnntnvfsigtgaceyyvmpgetaanam
    ysrklvkaqpiigkmndmiqmytdksrpkyctekgmvdeivdmtevrpyiqafteaayqn
    pqsicpmhqmltprstrefetf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3glmB (B:)
    mnmysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnerg
    qlsamqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmag
    awvpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnq
    lgipvivgiygtnpagggyhsisptiliahqdanmavggagilsgmnpkgyiddeaaeqi
    iaaqiensklkvpapgsvpihydetgffrevyqndlgvidgikkyisylpaynleffrvd
    tpkapqlpaedlysiipmnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngl
    lvgvianvqgllmnypeykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgi
    dvgdeaekaellglgqsliysiensklpsleitirkasaaahyvlggpqgnntnvfsigt
    gaceyyvmpgetaanamysrklvkakkagedlqpiigkmndmiqmytdksrpkyctekgm
    vdeivdmtevrpyiqafteaayqnpqsicpmhqmltprstrefetfgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glmB (B:)
    mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql
    samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw
    vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg
    ipvivgiygtnpagggyhsisptiliahqdanmavggagaeqiiaaqiensklkvpapgs
    vpihydetgffrevyqndlgvidgikkyisylpaynleffrvdtpkapqlpaedlysiip
    mnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngllvgvianvqgllmnype
    ykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgidvgdeaekaellglgqs
    liysiensklpsleitirkasaaahyvlggpqgnntnvfsigtgaceyyvmpgetaanam
    ysrklvkaqpiigkmndmiqmytdksrpkyctekgmvdeivdmtevrpyiqafteaayqn
    pqsicpmhqmltprstrefetf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3glmC (C:)
    mnmysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnerg
    qlsamqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmag
    awvpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnq
    lgipvivgiygtnpagggyhsisptiliahqdanmavggagilsgmnpkgyiddeaaeqi
    iaaqiensklkvpapgsvpihydetgffrevyqndlgvidgikkyisylpaynleffrvd
    tpkapqlpaedlysiipmnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngl
    lvgvianvqgllmnypeykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgi
    dvgdeaekaellglgqsliysiensklpsleitirkasaaahyvlggpqgnntnvfsigt
    gaceyyvmpgetaanamysrklvkakkagedlqpiigkmndmiqmytdksrpkyctekgm
    vdeivdmtevrpyiqafteaayqnpqsicpmhqmltprstrefetfgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glmC (C:)
    mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql
    samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw
    vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg
    ipvivgiygtnpagggyhsisptiliahqdanmavggagaeqiiaaqiensklkvpapgs
    vpihydetgffrevyqndlgvidgikkyisylpaynleffrvdtpkapqlpaedlysiip
    mnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngllvgvianvqgllmnype
    ykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgidvgdeaekaellglgqs
    liysiensklpsleitirkasaaahyvlggpqgnntnvfsigtgaceyyvmpgetaanam
    ysrkqpiigkmndmiqmytdksrpkyctekgmvdeivdmtevrpyiqafteaayqnpqsi
    cpmhqmltprstrefetf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3glmD (D:)
    mnmysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnerg
    qlsamqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmag
    awvpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnq
    lgipvivgiygtnpagggyhsisptiliahqdanmavggagilsgmnpkgyiddeaaeqi
    iaaqiensklkvpapgsvpihydetgffrevyqndlgvidgikkyisylpaynleffrvd
    tpkapqlpaedlysiipmnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngl
    lvgvianvqgllmnypeykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgi
    dvgdeaekaellglgqsliysiensklpsleitirkasaaahyvlggpqgnntnvfsigt
    gaceyyvmpgetaanamysrklvkakkagedlqpiigkmndmiqmytdksrpkyctekgm
    vdeivdmtevrpyiqafteaayqnpqsicpmhqmltprstrefetfgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3glmD (D:)
    mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql
    samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw
    vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg
    ipvivgiygtnpagggyhsisptiliahqdanmavggagaeqiiaaqiensklkvpapgs
    vpihydetgffrevyqndlgvidgikkyisylpaynleffrvdtpkapqlpaedlysiip
    mnqkrpydiyeviarlfdnsefseykkgygpemvtglakvngllvgvianvqgllmnype
    ykqnsvgiggklyrqglikmnefvtlcardripliwlqdttgidvgdeaekaellglgqs
    liysiensklpsleitirkasaaahyvlggpqgnntnvfsigtgaceyyvmpgetaanam
    ysrklvkaqpiigkmndmiqmytdksrpkyctekgmvdeivdmtevrpyiqafteaayqn
    pqsicpmhqmltprstrefetf