PDB entry 3gl6

View 3gl6 on RCSB PDB site
Description: crystal structure of jarid1a-phd3 complexed with h3(1-9)k4me3 peptide
Deposited on 2009-03-11, released 2009-05-05
The last revision was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone demethylase JARID1A
    Species: Homo sapiens [TaxId:9606]
    Gene: JARID1A, RBBP2, RBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29375 (1-51)
      • expression tag (0)
  • Chain 'B':
    Compound: histone h3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3GL6 (0-End)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3gl6A (A:)
svcaaqncqrpckdkvdwvqcdggcdewfhqvcvgvspemaenedyicinca

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3gl6B (B:)
artkqtark

    Sequence, based on observed residues (ATOM records):
    >3gl6B (B:)
artkqtar