PDB entry 3gl4

View 3gl4 on RCSB PDB site
Description: X-ray structure of photobleached killerred
Class: fluorescent protein
Keywords: fluorescent protein, genetically encoded photosensitizer, killerred, phototoxicity
Deposited on 2009-03-11, released 2009-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.232
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KillerRed
    Species: Anthomedusae sp. DC-2005 [TaxId:328397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2TCH5
      • chromophore (64)
    Domains in SCOPe 2.06: d3gl4a_
  • Chain 'B':
    Compound: KillerRed
    Species: Anthomedusae sp. DC-2005 [TaxId:328397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2TCH5
      • chromophore (64)
    Domains in SCOPe 2.06: d3gl4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gl4A (A:)
    meggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpi
    chliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsr
    itvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdsk
    mtfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaigsded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gl4A (A:)
    eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
    hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
    tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
    tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gl4B (B:)
    meggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpi
    chliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsr
    itvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdsk
    mtfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaigsded
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gl4B (B:)
    eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
    hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
    tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
    tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaig